PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM02G26410.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Trihelix
Protein Properties Length: 608aa    MW: 65655.8 Da    PI: 4.6643
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM02G26410.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix93.32.4e-2968152187
         trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                      rW+++e+laLi++r+em+ ++r++ lk+p Wee s++++e g++rs k+Ckek+en+ k+yk++keg+ +r++++s  +++f+qlea
  OGLUM02G26410.1  68 RWPREETLALIRIRSEMDAAFRNATLKAPVWEELSRRLAELGYQRSGKKCKEKFENVDKYYKRTKEGRTGRQDGKS--YRFFSQLEA 152
                      8*********************************************************************866665..*******85 PP

2trihelix1086.1e-34375460187
         trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                      rW+k+ev+aLi++r e+ee++++   k+plWee+++ m++ g++rs+k+Ckekwen+nk++kk+ke++k+r +e+s+tcpyf+ql+a
  OGLUM02G26410.1 375 RWPKEEVQALIDLRMEKEEQYNDMGPKGPLWEEIAAGMQRIGYNRSAKRCKEKWENINKYFKKVKESNKRR-PEDSKTCPYFHQLDA 460
                      8********************************************************************97.99***********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.2265127IPR001005SANT/Myb domain
CDDcd122033.95E-2767132No hitNo description
PfamPF138375.4E-2167153No hitNo description
PROSITE profilePS500907.08567125IPR017877Myb-like domain
SMARTSM007171.0E-5372434IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.8E-5374431IPR009057Homeodomain-like
PROSITE profilePS500907.851374432IPR017877Myb-like domain
SuperFamilySSF466898.2E-5374442IPR009057Homeodomain-like
CDDcd122031.02E-26374439No hitNo description
PfamPF138372.4E-22375461No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010192Biological Processmucilage biosynthetic process
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 608 aa     Download sequence    Send to blast
MAAAFDLPPV TTPAPAAPSD VLLPTQPQVS GPEEFPAAAV NSNDDDMMMV DDVVVAGGVG  60
GSGSTGNRWP REETLALIRI RSEMDAAFRN ATLKAPVWEE LSRRLAELGY QRSGKKCKEK  120
FENVDKYYKR TKEGRTGRQD GKSYRFFSQL EALHAAAPPP PPQQRQGMPV EDPQPLAMAR  180
MMLPGAADLG FLSMSSESES DDESDEEEEE EEAVAPGGGG REGLGDDGDG DGEGGSSTRK  240
LMAMFEGMMR QVTEKQDAMQ RVFLETLEKW EAERTEREEA WRRKEVARIN REREQLSKER  300
AAAASRDAAL IAFLQRVGGA GGEPVRLSPS SAGATRHDAA AAGLQLVPVP APRAKAEDAW  360
AAAGGDGSGT TAPSRWPKEE VQALIDLRME KEEQYNDMGP KGPLWEEIAA GMQRIGYNRS  420
AKRCKEKWEN INKYFKKVKE SNKRRPEDSK TCPYFHQLDA IYRKKHFAGR GGGGGGVTIA  480
ASHSSLAIVT VSEQDNPSQR ELEGKSSNDV GNVQLAVPLL VHNAPYKKVE GSEGEPNVTA  540
AAEETDSDEM GGEYTDDGDD GDKMQYKIEF QKPTAGGGGD GNDAPVPATT AAATSSAPTS  600
NTSFLAVQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00243DAPTransfer from AT1G76880Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1117420.0AK111742.1 Oryza sativa Japonica Group cDNA clone:J023050K14, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015622654.10.0PREDICTED: trihelix transcription factor GTL1
TrEMBLA0A0D9YVP00.0A0A0D9YVP0_9ORYZ; Uncharacterized protein
STRINGLOC_Os02g43300.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP60638175
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76890.23e-46Trihelix family protein